DDHD2 Antikörper (N-Term)

Produktnummer ABIN632655

Produktdetails anti-DDHD2 Antikörper

Target: DDHD2 (DDHD Domain Containing 2 (DDHD2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDHD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DDHD2 antibody was raised against the N terminal of DDHD2

Aufreinigung: Affinity purified

Immunogen: DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDHD2 Blocking Peptide, catalog no. 33R-1971, is also available for use as a blocking control in assays to test for specificity of this DDHD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDHD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDHD2

Target: DDHD2 (DDHD Domain Containing 2 (DDHD2))

Andere Bezeichnung: DDHD2 (DDHD2 Produkte)

Synonyme: SAMWD1 antikoerper, SPG54 antikoerper, 2010305K11Rik antikoerper, mKIAA0725 antikoerper, DDHD domain containing 2 antikoerper, DDHD2 antikoerper, Ddhd2 antikoerper, ddhd2 antikoerper

Hintergrund: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

Molekulargewicht: 81 kDa (MW of target protein)