DLG4 Antikörper

Produktnummer ABIN632653

Produktdetails anti-DLG4 Antikörper

Target: DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLG4 Blocking Peptide, catalog no. 33R-1027, is also available for use as a blocking control in assays to test for specificity of this DLG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLG4

Target: DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))

Andere Bezeichnung: DLG4 (DLG4 Produkte)

Synonyme: 11 antikoerper, CG1725 antikoerper, CG1730 antikoerper, CPD antikoerper, DLG antikoerper, DLG-A antikoerper, Discs-large antikoerper, Dlg antikoerper, Dlg-A antikoerper, Dlg1 antikoerper, DlgA antikoerper, Dmel\\CG1725 antikoerper, Drodlg antikoerper, PSD95 antikoerper, SAP97 antikoerper, anon-EST:Posey93 antikoerper, anon-WO03040301.258 antikoerper, anon-WO03040301.260 antikoerper, anon-WO03040301.268 antikoerper, d. lg.-1 antikoerper, dlg antikoerper, dlg-1 antikoerper, dlg-A antikoerper, dlgA antikoerper, dlgS97 antikoerper, l(1)10Bf antikoerper, l(1)G0276 antikoerper, l(1)G0342 antikoerper, l(1)G0456 antikoerper, l(1)G19 antikoerper, l(1)L11 antikoerper, l(1)bwn antikoerper, l(1)d.lg-1 antikoerper, l(1)d.lg.-1 antikoerper, l(1)discs large antikoerper, l(1)dlg antikoerper, l(1)dlg-1 antikoerper, l(1)dlg1 antikoerper, l(1)l.pr.-2 antikoerper, l(1)lpr-2 antikoerper, misb antikoerper, dlgh4 antikoerper, psd95 antikoerper, sap90 antikoerper, sap-90 antikoerper, LLGL1 antikoerper, Dlgh4 antikoerper, PSD-95 antikoerper, SAP90 antikoerper, SAP90A antikoerper, Sap90 antikoerper, SAP-90 antikoerper, DLG4 antikoerper, discs large 1 antikoerper, discs, large homolog 4 antikoerper, discs large MAGUK scaffold protein 4 antikoerper, discs, large homolog 4b (Drosophila) antikoerper, discs, large homolog 4 (Drosophila) antikoerper, dlg1 antikoerper, dlg4 antikoerper, DLG4 antikoerper, dlg4b antikoerper, Dlg4 antikoerper

Hintergrund: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 85 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Synaptic Membrane, Skeletal Muscle Fiber Development, Asymmetric Protein Localization, Regulation of long-term Neuronal Synaptic Plasticity