FAM160B1 Antikörper (N-Term)

Produktnummer ABIN632652

Dieses Anti-FAM160B1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FAM160B1 in WB. Geeignet für Human.

Kurzübersicht für FAM160B1 Antikörper (N-Term) (ABIN632652)

Target: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM160B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM160B1 Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM160 B1 antibody was raised against the N terminal of FAM160 1

Aufreinigung: Affinity purified

Immunogen: FAM160 B1 antibody was raised using the N terminal of FAM160 1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM160B1 Blocking Peptide, (ABIN939270), is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM160 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM160B1

Target: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Andere Bezeichnung: FAM160B1

Hintergrund: The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 86 kDa (MW of target protein)