GPALPP1 Antikörper (Middle Region)

Produktnummer ABIN632646

Produktdetails anti-GPALPP1 Antikörper

Target: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPALPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA1704 antibody was raised against the middle region of KIAA1704

Aufreinigung: Affinity purified

Immunogen: KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1704 Blocking Peptide, catalog no. 33R-4232, is also available for use as a blocking control in assays to test for specificity of this KIAA1704 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1704 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPALPP1

Target: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Andere Bezeichnung: KIAA1704 (GPALPP1 Produkte)

Synonyme: KIAA1704 antikoerper, LSR7 antikoerper, RP11-245H20.2 antikoerper, bA245H20.2 antikoerper, 1200011I18Rik antikoerper, Kiaa1704 antikoerper, fc50h08 antikoerper, wu:fc50h08 antikoerper, zgc:91844 antikoerper, GPALPP motifs containing 1 antikoerper, GPALPP1 antikoerper, Gpalpp1 antikoerper, gpalpp1 antikoerper

Hintergrund: The function of KIAA1704 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 38 kDa (MW of target protein)