GPALPP1 Antikörper (Middle Region)

Produktnummer ABIN632646

Dieses Anti-GPALPP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GPALPP1 in WB. Geeignet für Human.

Kurzübersicht für GPALPP1 Antikörper (Middle Region) (ABIN632646)

Target: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPALPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPALPP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KIAA1704 antibody was raised against the middle region of KIAA1704

Aufreinigung: Affinity purified

Immunogen: KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1704 Blocking Peptide, (ABIN939618), is also available for use as a blocking control in assays to test for specificity of this KIAA1704 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1704 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPALPP1

Target: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Andere Bezeichnung: KIAA1704

Hintergrund: The function of KIAA1704 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 38 kDa (MW of target protein)