TBC1D24 Antikörper (Middle Region)

Produktnummer ABIN632637

Dieses Anti-TBC1D24-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TBC1D24 in WB. Geeignet für Human.

Kurzübersicht für TBC1D24 Antikörper (Middle Region) (ABIN632637)

Target: TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBC1D24 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TBC1 D24 antibody was raised against the middle region of TBC1 24

Aufreinigung: Affinity purified

Immunogen: TBC1 D24 antibody was raised using the middle region of TBC1 24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D24 Blocking Peptide, (ABIN5616518), is also available for use as a blocking control in assays to test for specificity of this TBC1D24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D24

Target: TBC1D24 (TBC1 Domain Family, Member 24 (TBC1D24))

Andere Bezeichnung: TBC1D24

Hintergrund: TBC1D24 may act as a GTPase-activating protein for Rab family proteins.

Molekulargewicht: 62 kDa (MW of target protein)