THNSL2 Antikörper

Produktnummer ABIN632635

Produktdetails anti-THNSL2 Antikörper

Target: THNSL2 (threonine Synthase-Like 2 (THNSL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THNSL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THNSL2 Blocking Peptide, catalog no. 33R-5274, is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THNSL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THNSL2

Target: THNSL2 (threonine Synthase-Like 2 (THNSL2))

Andere Bezeichnung: THNSL2 (THNSL2 Produkte)

Synonyme: BC051244 antikoerper, TSH2 antikoerper, SOFAT antikoerper, THS2 antikoerper, RGD1309144 antikoerper, Tsh2 antikoerper, zgc:123281 antikoerper, threonine synthase-like 2 (bacterial) antikoerper, threonine synthase like 2 antikoerper, threonine synthase-like 2 antikoerper, Thnsl2 antikoerper, THNSL2 antikoerper, thnsl2 antikoerper

Hintergrund: THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Molekulargewicht: 54 kDa (MW of target protein)