TOM1 Antikörper

Produktnummer ABIN632634

Der Kaninchen Polyklonal anti-TOM1 Antikörper (ABIN632634) detektiert spezifisch TOM1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TOM1 Antikörper (ABIN632634)

Target: TOM1 (Target of Myb 1 (TOM1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TOM1 Antikörper

Aufreinigung: Affinity purified

Immunogen: TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOM1 Blocking Peptide, (ABIN5616727), is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOM1

Target: TOM1 (Target of Myb 1 (TOM1))

Andere Bezeichnung: TOM1

Hintergrund: This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 54 kDa (MW of target protein)