RPE Antikörper (N-Term)

Produktnummer ABIN632630

Produktdetails anti-RPE Antikörper

Target: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPE antibody was raised against the N terminal of RPE

Aufreinigung: Affinity purified

Immunogen: RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPE Blocking Peptide, catalog no. 33R-1339, is also available for use as a blocking control in assays to test for specificity of this RPE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPE

Target: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Andere Bezeichnung: RPE (RPE Produkte)

Synonyme: wu:fa07h08 antikoerper, wu:fb93d11 antikoerper, wu:fc20b11 antikoerper, ik:tdsubc_2c8 antikoerper, xx:tdsubc_2c8 antikoerper, RPE2-1 antikoerper, 2810429B02Rik antikoerper, 5730518J08Rik antikoerper, ribulose-5-phosphate-3-epimerase antikoerper, rpe antikoerper, RPE antikoerper, Rpe antikoerper

Hintergrund: RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.

Molekulargewicht: 19 kDa (MW of target protein)