RPE Antikörper (N-Term)

Produktnummer ABIN632630

Der Kaninchen Polyklonal Anti-RPE-Antikörper wurde für WB validiert. Er ist geeignet, RPE in Proben von Human zu detektieren.

Kurzübersicht für RPE Antikörper (N-Term) (ABIN632630)

Target: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPE Antikörper

Bindungsspezifität: N-Term

Spezifität: RPE antibody was raised against the N terminal of RPE

Aufreinigung: Affinity purified

Immunogen: RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RPE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPE

Target: RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))

Andere Bezeichnung: RPE

Hintergrund: RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.

Molekulargewicht: 19 kDa (MW of target protein)