MAT2A Antikörper (Middle Region)

Produktnummer ABIN632627

Der Kaninchen Polyklonal anti-MAT2A Antikörper wird verwendet zum Nachweis von MAT2A in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für MAT2A Antikörper (Middle Region) (ABIN632627)

Target: MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAT2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAT2A Antikörper

Bindungsspezifität: Middle Region

Spezifität: MAT2 A antibody was raised against the middle region of MAT2

Aufreinigung: Affinity purified

Immunogen: MAT2 A antibody was raised using the middle region of MAT2 corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAT2A Blocking Peptide, (ABIN940514), is also available for use as a blocking control in assays to test for specificity of this MAT2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAT2A

Target: MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))

Andere Bezeichnung: MAT2A

Hintergrund: MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process