MAT2A Antikörper (Middle Region)
-
- Target Alle MAT2A Antikörper anzeigen
- MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAT2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAT2 A antibody was raised against the middle region of MAT2
- Aufreinigung
- Affinity purified
- Immunogen
- MAT2 A antibody was raised using the middle region of MAT2 corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK
- Top Product
- Discover our top product MAT2A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAT2A Blocking Peptide, catalog no. 33R-5128, is also available for use as a blocking control in assays to test for specificity of this MAT2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))
- Andere Bezeichnung
- MAT2A (MAT2A Produkte)
- Synonyme
- MATA2 antikoerper, MATII antikoerper, SAMS2 antikoerper, Sams2 antikoerper, D630045P18Rik antikoerper, fd12a12 antikoerper, mat2a antikoerper, si:ch73-340n8.1 antikoerper, wu:fb95e01 antikoerper, wu:fd12a12 antikoerper, m(2)21ab antikoerper, MGC76253 antikoerper, MGC79598 antikoerper, zgc:110847 antikoerper, methionine adenosyltransferase 2A antikoerper, methionine adenosyltransferase II, alpha antikoerper, methionine adenosyltransferase II, alpha a antikoerper, methionine adenosyltransferase II, alpha L homeolog antikoerper, methionine adenosyltransferase II, alpha b antikoerper, MAT2A antikoerper, Mat2a antikoerper, mat2aa antikoerper, mat2a.L antikoerper, mat2a antikoerper, mat2ab antikoerper
- Hintergrund
- MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process
-