SPATA24 Antikörper (C-Term)

Produktnummer ABIN632623

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SPATA24 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SPATA24 Antikörper (C-Term) (ABIN632623)

Target: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SPATA24 Antikörper

Bindungsspezifität: C-Term

Spezifität: SPATA24 antibody was raised against the c terminal of SPATA24

Aufreinigung: Affinity purified

Immunogen: SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA24 Blocking Peptide, (ABIN5616361), is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA24

Target: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Andere Bezeichnung: SPATA24

Hintergrund: SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.

Molekulargewicht: 23 kDa (MW of target protein)