Neurexophilin 4 Antikörper (N-Term)

Produktnummer ABIN632622

Dieses Anti-Neurexophilin 4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Neurexophilin 4 in WB. Geeignet für Human.

Kurzübersicht für Neurexophilin 4 Antikörper (N-Term) (ABIN632622)

Target: Neurexophilin 4 (NXPH4)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neurexophilin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Neurexophilin 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: Neurexophilin 4 antibody was raised against the N terminal of NXPH4

Aufreinigung: Affinity purified

Immunogen: Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neurexophilin 4 Blocking Peptide, (ABIN5614967), is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neurexophilin 4

Target: Neurexophilin 4 (NXPH4)

Andere Bezeichnung: Neurexophilin 4

Hintergrund: NXPH4 may be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Molekulargewicht: 34 kDa (MW of target protein)