AKR1C2 Antikörper

Produktnummer ABIN632618

Der Kaninchen Polyklonal Anti-AKR1C2-Antikörper wurde für WB validiert. Er ist geeignet, AKR1C2 in Proben von Human zu detektieren.

Kurzübersicht für AKR1C2 Antikörper (ABIN632618)

Target: AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKR1C2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AKR1C2 Antikörper

Aufreinigung: Affinity purified

Immunogen: AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKR1C2 Blocking Peptide, (ABIN940266), is also available for use as a blocking control in assays to test for specificity of this AKR1C2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKR1C2

Target: AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))

Andere Bezeichnung: AKR1C2

Hintergrund: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process