XRRA1 Antikörper (N-Term)

Produktnummer ABIN632615

Der Kaninchen Polyklonal anti-XRRA1 Antikörper wird verwendet zum Nachweis von XRRA1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für XRRA1 Antikörper (N-Term) (ABIN632615)

Target: XRRA1 (X-Ray Radiation Resistance Associated 1 (XRRA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XRRA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XRRA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: XRRA1 antibody was raised against the N terminal of XRRA1

Aufreinigung: Affinity purified

Immunogen: XRRA1 antibody was raised using the N terminal of XRRA1 corresponding to a region with amino acids MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XRRA1 Blocking Peptide, (ABIN5617048), is also available for use as a blocking control in assays to test for specificity of this XRRA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRRA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XRRA1

Target: XRRA1 (X-Ray Radiation Resistance Associated 1 (XRRA1))

Andere Bezeichnung: XRRA1

Hintergrund: XRRA1 may be involved in the response of cells to X-ray radiation.

Molekulargewicht: 90 kDa (MW of target protein)