C13orf30 Antikörper (N-Term)

Produktnummer ABIN632614

Produktdetails anti-C13orf30 Antikörper

Target: C13orf30 (Chromosome 13 Open Reading Frame 30 (C13orf30))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C13orf30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C13 orf30 antibody was raised against the N terminal of C13 rf30

Aufreinigung: Affinity purified

Immunogen: C13 orf30 antibody was raised using the N terminal of C13 rf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C13orf30 Blocking Peptide, catalog no. 33R-6063, is also available for use as a blocking control in assays to test for specificity of this C13orf30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C13orf30

Target: C13orf30 (Chromosome 13 Open Reading Frame 30 (C13orf30))

Andere Bezeichnung: C13orf30 (C13orf30 Produkte)

Synonyme: C12H13orf30 antikoerper, C13orf30 antikoerper, 9330158N17 antikoerper, AU021034 antikoerper, family with sequence similarity 216 member B antikoerper, family with sequence similarity 216, member B antikoerper, FAM216B antikoerper, Fam216b antikoerper

Hintergrund: The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 16 kDa (MW of target protein)