GBP2 Antikörper (N-Term)

Produktnummer ABIN632613

Produktdetails anti-GBP2 Antikörper

Target: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GBP2 antibody was raised against the N terminal of GBP2

Aufreinigung: Affinity purified

Immunogen: GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GBP2 Blocking Peptide, catalog no. 33R-3881, is also available for use as a blocking control in assays to test for specificity of this GBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GBP2

Target: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Andere Bezeichnung: GBP2 (GBP2 Produkte)

Synonyme: guanylate binding protein 2 antikoerper, guanylate binding protein 2, interferon-inducible antikoerper, GTP binding protein 2 L homeolog antikoerper, GBP2 antikoerper, Gbp2 antikoerper, gtpbp2.L antikoerper

Hintergrund: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin