MAGEB4 Antikörper (N-Term)

Produktnummer ABIN632604

Produktdetails anti-MAGEB4 Antikörper

Target: MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEB4 antibody was raised against the N terminal of MAGEB4

Aufreinigung: Affinity purified

Immunogen: MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEB4 Blocking Peptide, catalog no. 33R-4329, is also available for use as a blocking control in assays to test for specificity of this MAGEB4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEB4

Target: MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))

Andere Bezeichnung: MAGEB4 (MAGEB4 Produkte)

Synonyme: CT3.6 antikoerper, MAGEB4 antikoerper, MGC133739 antikoerper, CN716893 antikoerper, Mage-b4 antikoerper, mMage-b4 antikoerper, RGD1561997 antikoerper, MAGE family member B4 antikoerper, melanoma antigen family B, 4 antikoerper, melanoma antigen, family B, 4 antikoerper, MAGEB4 antikoerper, Mageb4 antikoerper

Hintergrund: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Molekulargewicht: 39 kDa (MW of target protein)