MAGEB4 Antikörper (N-Term)
-
- Target Alle MAGEB4 Antikörper anzeigen
- MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))
-
Bindungsspezifität
- N-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAGEB4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAGEB4 antibody was raised against the N terminal of MAGEB4
- Aufreinigung
- Affinity purified
- Immunogen
- MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD
- Top Product
- Discover our top product MAGEB4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAGEB4 Blocking Peptide, catalog no. 33R-4329, is also available for use as a blocking control in assays to test for specificity of this MAGEB4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))
- Andere Bezeichnung
- MAGEB4 (MAGEB4 Produkte)
- Hintergrund
- This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.
- Molekulargewicht
- 39 kDa (MW of target protein)
-