LHPP Antikörper (Middle Region)

Produktnummer ABIN632600

Produktdetails anti-LHPP Antikörper

Target: LHPP (Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LHPP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LHPP antibody was raised against the middle region of LHPP

Aufreinigung: Affinity purified

Immunogen: LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LHPP Blocking Peptide, catalog no. 33R-1067, is also available for use as a blocking control in assays to test for specificity of this LHPP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LHPP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LHPP

Target: LHPP (Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP))

Andere Bezeichnung: LHPP (LHPP Produkte)

Synonyme: HDHD2B antikoerper, 2310007H09Rik antikoerper, zgc:165670 antikoerper, phospholysine phosphohistidine inorganic pyrophosphate phosphatase antikoerper, haloacid dehalogenase-like hydrolase domain-containing protein 2 antikoerper, phospholysine phosphohistidine inorganic pyrophosphate phosphatase S homeolog antikoerper, LHPP antikoerper, LB_102 antikoerper, PSPPH_2719 antikoerper, LOC5569494 antikoerper, CpipJ_CPIJ005727 antikoerper, Lhpp antikoerper, lhpp.S antikoerper, lhpp antikoerper

Hintergrund: The function of LHPP protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 29 kDa (MW of target protein)