ALDH7A1 Antikörper (N-Term)

Produktnummer ABIN632598

Produktdetails anti-ALDH7A1 Antikörper

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH7A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALDH7 A1 antibody was raised against the N terminal of ALDH7 1

Aufreinigung: Affinity purified

Immunogen: ALDH7 A1 antibody was raised using the N terminal of ALDH7 1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH7A1 Blocking Peptide, catalog no. 33R-6842, is also available for use as a blocking control in assays to test for specificity of this ALDH7A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH7A1

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Andere Bezeichnung: ALDH7A1 (ALDH7A1 Produkte)

Synonyme: atq1 antikoerper, ALDH7A1 antikoerper, ATQ1 antikoerper, EPD antikoerper, PDE antikoerper, antiquitin antikoerper, ATQ antikoerper, wu:fi34d12 antikoerper, wu:fi35e06 antikoerper, Atq1 antikoerper, D18Wsu181e antikoerper, aldehyde dehydrogenase 7 family member A1 antikoerper, aldehyde dehydrogenase 7 family member A1 L homeolog antikoerper, aldehyde dehydrogenase 7 family, member A1 antikoerper, aldehyde dehydrogenase family 7, member A1 antikoerper, ALDH7A1 antikoerper, aldh7a1 antikoerper, aldh7a1.L antikoerper, Aldh7a1 antikoerper

Hintergrund: Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Sensory Perception of Sound