RIBC1 Antikörper (Middle Region)

Produktnummer ABIN632596

Produktdetails anti-RIBC1 Antikörper

Target: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RIBC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RIBC1 antibody was raised against the middle region of RIBC1

Aufreinigung: Affinity purified

Immunogen: RIBC1 antibody was raised using the middle region of RIBC1 corresponding to a region with amino acids ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RIBC1 Blocking Peptide, catalog no. 33R-1393, is also available for use as a blocking control in assays to test for specificity of this RIBC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIBC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RIBC1

Target: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Andere Bezeichnung: RIBC1 (RIBC1 Produkte)

Synonyme: MGC131291 antikoerper, sb:eu690 antikoerper, zgc:158280 antikoerper, si:dkey-23g9.1 antikoerper, 2610028I09Rik antikoerper, W08639 antikoerper, RIB43A domain with coiled-coils 1 antikoerper, RIB43A domain with coiled-coils 1 L homeolog antikoerper, RIBC1 antikoerper, ribc1.L antikoerper, ribc1 antikoerper, Ribc1 antikoerper

Hintergrund: The function of RIBC1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 44 kDa (MW of target protein)