RIBC1 Antikörper (Middle Region)

Produktnummer ABIN632596

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch RIBC1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RIBC1 Antikörper (Middle Region) (ABIN632596)

Target: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RIBC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RIBC1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RIBC1 antibody was raised against the middle region of RIBC1

Aufreinigung: Affinity purified

Immunogen: RIBC1 antibody was raised using the middle region of RIBC1 corresponding to a region with amino acids ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RIBC1 Blocking Peptide, (ABIN936779), is also available for use as a blocking control in assays to test for specificity of this RIBC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIBC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RIBC1

Target: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Andere Bezeichnung: RIBC1

Hintergrund: The function of RIBC1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 44 kDa (MW of target protein)