HS1BP3 Antikörper (N-Term)

Produktnummer ABIN632591

Produktdetails anti-HS1BP3 Antikörper

Target: HS1BP3 (HCLS1 Binding Protein 3 (HS1BP3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HS1BP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HS1 BP3 antibody was raised against the N terminal of HS1 P3

Aufreinigung: Affinity purified

Immunogen: HS1 BP3 antibody was raised using the N terminal of HS1 P3 corresponding to a region with amino acids YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HS1BP3 Blocking Peptide, catalog no. 33R-10239, is also available for use as a blocking control in assays to test for specificity of this HS1BP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 P3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HS1BP3

Target: HS1BP3 (HCLS1 Binding Protein 3 (HS1BP3))

Andere Bezeichnung: HS1BP3 (HS1BP3 Produkte)

Synonyme: HS1BP3 antikoerper, DKFZp468N116 antikoerper, ETM2 antikoerper, HS1-BP3 antikoerper, RGD1311331 antikoerper, HCLS1 binding protein 3 antikoerper, HCLS1 binding protein 3 S homeolog antikoerper, HS1BP3 antikoerper, hs1bp3.S antikoerper, hs1bp3 antikoerper, Hs1bp3 antikoerper

Hintergrund: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Molekulargewicht: 43 kDa (MW of target protein)