ACBD3 Antikörper (N-Term)

Produktnummer ABIN632589

Produktdetails anti-ACBD3 Antikörper

Target: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACBD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACBD3 antibody was raised against the N terminal of ACBD3

Aufreinigung: Affinity purified

Immunogen: ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACBD3 Blocking Peptide, catalog no. 33R-2282, is also available for use as a blocking control in assays to test for specificity of this ACBD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACBD3

Target: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Andere Bezeichnung: ACBD3 (Acbd3 Produkte)

Synonyme: ACBD3 antikoerper, 60kDa antikoerper, 8430407O11Rik antikoerper, D1Ertd10e antikoerper, GCP60 antikoerper, GOLPH1 antikoerper, Gocap1 antikoerper, Pap7 antikoerper, fa20g08 antikoerper, si:dkey-267p15.1 antikoerper, wu:fa20g08 antikoerper, zgc:66303 antikoerper, GOCAP1 antikoerper, PAP7 antikoerper, acbd3 antikoerper, MGC122176 antikoerper, T22A6.60 antikoerper, T22A6_60 antikoerper, acyl-CoA-binding domain 3 antikoerper, acyl-CoA binding domain containing 3 antikoerper, acyl-Coenzyme A binding domain containing 3 antikoerper, acyl-CoA binding domain containing 3 L homeolog antikoerper, acyl-CoA-binding domain 3 antikoerper, ACBD3 antikoerper, Acbd3 antikoerper, acbd3 antikoerper, acbd3.L antikoerper, ACBP3 antikoerper

Hintergrund: The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Molekulargewicht: 60 kDa (MW of target protein)