ACBD3 Antikörper (N-Term)

Produktnummer ABIN632589

Dieses Anti-ACBD3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ACBD3 in WB. Geeignet für Human.

Kurzübersicht für ACBD3 Antikörper (N-Term) (ABIN632589)

Target: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACBD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACBD3 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACBD3 antibody was raised against the N terminal of ACBD3

Aufreinigung: Affinity purified

Immunogen: ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACBD3 Blocking Peptide, (ABIN937668), is also available for use as a blocking control in assays to test for specificity of this ACBD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACBD3

Target: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Andere Bezeichnung: ACBD3

Hintergrund: The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Molekulargewicht: 60 kDa (MW of target protein)