DUS1L Antikörper

Produktnummer ABIN632586

Produktdetails anti-DUS1L Antikörper

Target: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUS1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUS1L Blocking Peptide, catalog no. 33R-4595, is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DUS1L

Target: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Andere Bezeichnung: DUS1L (DUS1L Produkte)

Synonyme: zgc:63748 antikoerper, wu:fb71f06 antikoerper, DUS1 antikoerper, PP3111 antikoerper, 1110032N12Rik antikoerper, Dus1l antikoerper, x85 antikoerper, dihydrouridine synthase 1-like (S. cerevisiae) antikoerper, dihydrouridine synthase 1 like antikoerper, tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like antikoerper, dihydrouridine synthase 1-like (S. cerevisiae) pseudogene antikoerper, dihydrouridine synthase 1-like antikoerper, dus1l antikoerper, DUS1L antikoerper, LOC745178 antikoerper, LOC100408764 antikoerper, Dus1l antikoerper

Hintergrund: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Molekulargewicht: 53 kDa (MW of target protein)