DUS1L Antikörper
-
- Target Alle DUS1L Antikörper anzeigen
- DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DUS1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK
- Top Product
- Discover our top product DUS1L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DUS1L Blocking Peptide, catalog no. 33R-4595, is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUS0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))
- Andere Bezeichnung
- DUS1L (DUS1L Produkte)
- Hintergrund
- DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
- Molekulargewicht
- 53 kDa (MW of target protein)
-