DUS1L Antikörper

Produktnummer ABIN632586

Dieser Anti-DUS1L Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von DUS1L in WB. Geeignet für Human.

Kurzübersicht für DUS1L Antikörper (ABIN632586)

Target: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DUS1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DUS1L Antikörper

Aufreinigung: Affinity purified

Immunogen: DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUS1L Blocking Peptide, (ABIN939981), is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DUS1L

Target: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Andere Bezeichnung: DUS1L

Hintergrund: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Molekulargewicht: 53 kDa (MW of target protein)