WDFY1 Antikörper (N-Term)
-
- Target Alle WDFY1 Antikörper anzeigen
- WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WDFY1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDFY1 antibody was raised against the N terminal of WDFY1
- Aufreinigung
- Affinity purified
- Immunogen
- WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV
- Top Product
- Discover our top product WDFY1 Primärantikörper
-
anti-WD Repeat and FYVE Domain Containing 1 (WDFY1) (AA 261-357) antibody
WDFY1 Reaktivität: Human ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat and FYVE Domain Containing 1 (WDFY1) (AA 42-91) antibodyWDFY1 Reaktivität: Human, Ratte, Maus, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Fledermaus, Huhn WB, IHC (p), IHC Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat and FYVE Domain Containing 1 (WDFY1) (N-Term) antibodyWDFY1 Reaktivität: Human, Ratte, Maus, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Huhn WB, IHC (p), IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDFY1 Blocking Peptide, catalog no. 33R-5591, is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))
- Andere Bezeichnung
- WDFY1 (WDFY1 Produkte)
- Synonyme
- FENS-1 antikoerper, WDF1 antikoerper, ZFYVE17 antikoerper, 1700013B03Rik antikoerper, 1700120F24Rik antikoerper, Jr1 antikoerper, mKIAA1435 antikoerper, MGC93914 antikoerper, zgc:101764 antikoerper, zgc:109909 antikoerper, WD repeat and FYVE domain containing 1 antikoerper, WDFY1 antikoerper, Wdfy1 antikoerper, wdfy1 antikoerper
- Hintergrund
- The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.
- Molekulargewicht
- 46 kDa (MW of target protein)
-
