WDFY1 Antikörper (N-Term)

Produktnummer ABIN632585

Der Kaninchen Polyklonal Anti-WDFY1-Antikörper wurde für WB validiert. Er ist geeignet, WDFY1 in Proben von Human zu detektieren.

Kurzübersicht für WDFY1 Antikörper (N-Term) (ABIN632585)

Target: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDFY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WDFY1 Antikörper

Bindungsspezifität: N-Term

Spezifität: WDFY1 antibody was raised against the N terminal of WDFY1

Aufreinigung: Affinity purified

Immunogen: WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDFY1 Blocking Peptide, (ABIN5616993), is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDFY1

Target: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Andere Bezeichnung: WDFY1

Hintergrund: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.

Molekulargewicht: 46 kDa (MW of target protein)