KLHDC9 Antikörper (Middle Region)

Produktnummer ABIN632579

Produktdetails anti-KLHDC9 Antikörper

Target: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLHDC9 antibody was raised against the middle region of KLHDC9

Aufreinigung: Affinity purified

Immunogen: KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC9 Blocking Peptide, catalog no. 33R-1143, is also available for use as a blocking control in assays to test for specificity of this KLHDC9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC9

Target: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Andere Bezeichnung: KLHDC9 (KLHDC9 Produkte)

Synonyme: KARCA1 antikoerper, 1190002J23Rik antikoerper, AA087357 antikoerper, ESTM31 antikoerper, kelch domain containing 9 antikoerper, KLHDC9 antikoerper, Klhdc9 antikoerper

Hintergrund: The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 38 kDa (MW of target protein)