KLHDC9 Antikörper (Middle Region)

Produktnummer ABIN632579

Der Kaninchen Polyklonal Anti-KLHDC9-Antikörper wurde für WB validiert. Er ist geeignet, KLHDC9 in Proben von Human zu detektieren.

Kurzübersicht für KLHDC9 Antikörper (Middle Region) (ABIN632579)

Target: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHDC9 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KLHDC9 antibody was raised against the middle region of KLHDC9

Aufreinigung: Affinity purified

Immunogen: KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC9 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this KLHDC9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC9

Target: KLHDC9 (Kelch Domain Containing 9 (KLHDC9))

Andere Bezeichnung: KLHDC9

Hintergrund: The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 38 kDa (MW of target protein)