C18ORF25 Antikörper (N-Term)

Produktnummer ABIN632578

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch C18ORF25 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für C18ORF25 Antikörper (N-Term) (ABIN632578)

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C18ORF25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C18ORF25 Antikörper

Bindungsspezifität: N-Term

Spezifität: C18 orf25 antibody was raised against the N terminal of C18 rf25

Aufreinigung: Affinity purified

Immunogen: C18 orf25 antibody was raised using the N terminal of C18 rf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C18orf25 Blocking Peptide, (ABIN5612434), is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C18ORF25

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Andere Bezeichnung: C18orf25

Hintergrund: The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 37 kDa (MW of target protein)