ARHGAP30 Antikörper (N-Term)

Produktnummer ABIN632572

Produktdetails anti-ARHGAP30 Antikörper

Target: ARHGAP30 (rho GTPase Activating Protein 30 (ARHGAP30))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGAP30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARHGAP30 antibody was raised against the N terminal of ARHGAP30

Aufreinigung: Affinity purified

Immunogen: ARHGAP30 antibody was raised using the N terminal of ARHGAP30 corresponding to a region with amino acids RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGAP30 Blocking Peptide, catalog no. 33R-8013, is also available for use as a blocking control in assays to test for specificity of this ARHGAP30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGAP30

Target: ARHGAP30 (rho GTPase Activating Protein 30 (ARHGAP30))

Andere Bezeichnung: ARHGAP30 (ARHGAP30 Produkte)

Synonyme: 6030405P05Rik antikoerper, Gm102 antikoerper, mFLJ00267 antikoerper, Rho GTPase activating protein 30 antikoerper, ARHGAP30 antikoerper, Arhgap30 antikoerper

Hintergrund: ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molekulargewicht: 98 kDa (MW of target protein)