Carboxypeptidase X Antikörper

Produktnummer ABIN632563

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Carboxypeptidase X in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Carboxypeptidase X Antikörper (ABIN632563)

Target: Carboxypeptidase X

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase X antibody was raised using a synthetic peptide corresponding to a region with amino acids MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase X Blocking Peptide, (ABIN5612619), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase X antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPXM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Carboxypeptidase X

Hintergrund: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Molekulargewicht: 80 kDa (MW of target protein)