DPH1 Antikörper

Produktnummer ABIN632548

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DPH1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DPH1 Antikörper (ABIN632548)

Target: DPH1 (DPH1 Homolog (DPH1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DPH1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPH1 Blocking Peptide, (ABIN5613243), is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPH1

Target: DPH1 (DPH1 Homolog (DPH1))

Andere Bezeichnung: DPH1

Hintergrund: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A.

Molekulargewicht: 49 kDa (MW of target protein)