ARL13B Antikörper (Middle Region)
-
- Target Alle ARL13B Antikörper anzeigen
- ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARL13B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARL13 B antibody was raised against the middle region of ARL13
- Aufreinigung
- Affinity purified
- Immunogen
- ARL13 B antibody was raised using the middle region of ARL13 corresponding to a region with amino acids RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR
- Top Product
- Discover our top product ARL13B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARL13B Blocking Peptide, catalog no. 33R-8244, is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))
- Andere Bezeichnung
- ARL13B (ARL13B Produkte)
- Synonyme
- ARL2L1 antikoerper, MGC185757 antikoerper, arl2l1 antikoerper, chunp6872 antikoerper, fc23g07 antikoerper, wu:fc23g07 antikoerper, zgc:123149 antikoerper, JBTS8 antikoerper, A530097K21Rik antikoerper, A930014M17Rik antikoerper, Arl2l1 antikoerper, C530009C10Rik antikoerper, hnn antikoerper, ADP-ribosylation factor like GTPase 13B antikoerper, ADP ribosylation factor like GTPase 13B antikoerper, ADP-ribosylation factor-like 13b antikoerper, ADP-ribosylation factor-like 13B antikoerper, Arl13b antikoerper, ARL13B antikoerper, arl13b antikoerper
- Hintergrund
- ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
- Molekulargewicht
- 37 kDa (MW of target protein)
-