GAS8 Antikörper (N-Term)

Produktnummer ABIN632541

Dieses Anti-GAS8-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GAS8 in WB. Geeignet für Human.

Kurzübersicht für GAS8 Antikörper (N-Term) (ABIN632541)

Target: GAS8 (Growth Arrest-Specific 8 (GAS8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GAS8 Antikörper

Bindungsspezifität: N-Term

Spezifität: GAS8 antibody was raised against the N terminal of GAS8

Aufreinigung: Affinity purified

Immunogen: GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAS8 Blocking Peptide, (ABIN5613729), is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAS8

Target: GAS8 (Growth Arrest-Specific 8 (GAS8))

Andere Bezeichnung: GAS8

Hintergrund: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

Molekulargewicht: 56 kDa (MW of target protein)