TNNI3K Antikörper (N-Term)

Produktnummer ABIN632533

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TNNI3K in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TNNI3K Antikörper (N-Term) (ABIN632533)

Target: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNNI3K Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TNNI3K Antikörper

Bindungsspezifität: N-Term

Spezifität: TNNI3 K antibody was raised against the N terminal of TNNI3

Aufreinigung: Affinity purified

Immunogen: TNNI3 K antibody was raised using the N terminal of TNNI3 corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNNI3K Blocking Peptide, (ABIN940540), is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNNI3K

Target: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Andere Bezeichnung: TNNI3K

Hintergrund: TNNI3K may play a role in cardiac physiology.

Molekulargewicht: 103 kDa (MW of target protein)