ZC2HC1C Antikörper (N-Term)

Produktnummer ABIN632527

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ZC2HC1C in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ZC2HC1C Antikörper (N-Term) (ABIN632527)

Target: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZC2HC1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZC2HC1C Antikörper

Bindungsspezifität: N-Term

Spezifität: C14 ORF140 antibody was raised against the N terminal Of C14 rf140

Aufreinigung: Affinity purified

Immunogen: C14 ORF140 antibody was raised using the N terminal Of C14 rf140 corresponding to a region with amino acids QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF140 Blocking Peptide, (ABIN5612409), is also available for use as a blocking control in assays to test for specificity of this C14ORF140 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF140 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZC2HC1C

Target: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Andere Bezeichnung: C14ORF140

Hintergrund: C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

Molekulargewicht: 31 kDa (MW of target protein)