CHAC1 Antikörper
-
- Target Alle CHAC1 Antikörper anzeigen
- CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHAC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
- Top Product
- Discover our top product CHAC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHAC1 Blocking Peptide, catalog no. 33R-9229, is also available for use as a blocking control in assays to test for specificity of this CHAC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))
- Andere Bezeichnung
- CHAC1 (CHAC1 Produkte)
- Synonyme
- 1810008K03Rik antikoerper, RGD1307153 antikoerper, ChaC glutathione specific gamma-glutamylcyclotransferase 1 antikoerper, ChaC, cation transport regulator 1 antikoerper, ChaC glutathione-specific gamma-glutamylcyclotransferase 1 antikoerper, CHAC1 antikoerper, Chac1 antikoerper
- Hintergrund
- CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
- Molekulargewicht
- 24 kDa (MW of target protein)
-