CHAC1 Antikörper

Produktnummer ABIN632509

Produktdetails anti-CHAC1 Antikörper

Target: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHAC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHAC1 Blocking Peptide, catalog no. 33R-9229, is also available for use as a blocking control in assays to test for specificity of this CHAC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHAC1

Target: CHAC1 (ChaC, Cation Transport Regulator Homolog 1 (CHAC1))

Andere Bezeichnung: CHAC1 (CHAC1 Produkte)

Synonyme: 1810008K03Rik antikoerper, RGD1307153 antikoerper, ChaC glutathione specific gamma-glutamylcyclotransferase 1 antikoerper, ChaC, cation transport regulator 1 antikoerper, ChaC glutathione-specific gamma-glutamylcyclotransferase 1 antikoerper, CHAC1 antikoerper, Chac1 antikoerper

Hintergrund: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Molekulargewicht: 24 kDa (MW of target protein)