MYH1 Antikörper (N-Term)

Produktnummer ABIN632502

Dieses Anti-MYH1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MYH1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für MYH1 Antikörper (N-Term) (ABIN632502)

Target: MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MYH1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MYH1 antibody was raised against the N terminal of MYH1

Aufreinigung: Affinity purified

Immunogen: MYH1 antibody was raised using the N terminal of MYH1 corresponding to a region with amino acids KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYH1 Blocking Peptide, (ABIN940081), is also available for use as a blocking control in assays to test for specificity of this MYH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYH1

Target: MYH1 (Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1))

Andere Bezeichnung: MYH1

Hintergrund: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP.

Molekulargewicht: 223 kDa (MW of target protein)