SPRR3 Antikörper (Middle Region)

Produktnummer ABIN632500

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SPRR3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SPRR3 Antikörper (Middle Region) (ABIN632500)

Target: SPRR3 (Small Proline-Rich Protein 3 (SPRR3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPRR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SPRR3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SPRR3 antibody was raised against the middle region of SPRR3

Aufreinigung: Affinity purified

Immunogen: SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPRR3 Blocking Peptide, (ABIN937515), is also available for use as a blocking control in assays to test for specificity of this SPRR3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPRR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPRR3

Target: SPRR3 (Small Proline-Rich Protein 3 (SPRR3))

Andere Bezeichnung: SPRR3

Hintergrund: SPRR3 is the cross-linked envelope protein of keratinocytes.

Molekulargewicht: 18 kDa (MW of target protein)