ADH1A Antikörper

Produktnummer ABIN632491

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ADH1A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ADH1A Antikörper (ABIN632491)

Target: ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADH1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADH1A Antikörper

Aufreinigung: Affinity purified

Immunogen: ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADH1A Blocking Peptide, (ABIN938125), is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADH1A

Target: ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))

Andere Bezeichnung: ADH1A

Hintergrund: ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Molekulargewicht: 40 kDa (MW of target protein)