TMCO6 Antikörper (N-Term)

Produktnummer ABIN632475

Produktdetails anti-TMCO6 Antikörper

Target: TMCO6 (Transmembrane and Coiled-Coil Domains 6 (TMCO6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMCO6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMCO6 antibody was raised against the N terminal of TMCO6

Aufreinigung: Affinity purified

Immunogen: TMCO6 antibody was raised using the N terminal of TMCO6 corresponding to a region with amino acids LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMCO6 Blocking Peptide, catalog no. 33R-5380, is also available for use as a blocking control in assays to test for specificity of this TMCO6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMCO6

Target: TMCO6 (Transmembrane and Coiled-Coil Domains 6 (TMCO6))

Andere Bezeichnung: TMCO6 (TMCO6 Produkte)

Synonyme: 2410015B03Rik antikoerper, transmembrane and coiled-coil domains 6 antikoerper, TMCO6 antikoerper, Tmco6 antikoerper

Hintergrund: The function of TMCO6 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 54 kDa (MW of target protein)