TRAPPC2L Antikörper (N-Term)

Produktnummer ABIN632473

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TRAPPC2L in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TRAPPC2L Antikörper (N-Term) (ABIN632473)

Target: TRAPPC2L

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAPPC2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRAPPC2L Antikörper

Bindungsspezifität: N-Term

Spezifität: TRAPPC2 L antibody was raised against the N terminal of TRAPPC2

Aufreinigung: Affinity purified

Immunogen: TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAPPC2L Blocking Peptide, (ABIN5616767), is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAPPC2L

Target: TRAPPC2L

Hintergrund: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Molekulargewicht: 16 kDa (MW of target protein)