FAM135B Antikörper (Middle Region)

Produktnummer ABIN632470

Produktdetails anti-FAM135B Antikörper

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM135B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM135 B antibody was raised against the middle region of FAM135

Aufreinigung: Affinity purified

Immunogen: FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM135B

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Andere Bezeichnung: FAM135B (FAM135B Produkte)

Hintergrund: The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 156 kDa (MW of target protein)