FAM135B Antikörper (Middle Region)

Produktnummer ABIN632470

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch FAM135B in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für FAM135B Antikörper (Middle Region) (ABIN632470)

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM135B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM135B Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM135 B antibody was raised against the middle region of FAM135

Aufreinigung: Affinity purified

Immunogen: FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM135B Blocking Peptide, (ABIN5613471), is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM135B

Target: FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))

Andere Bezeichnung: FAM135B

Hintergrund: The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 156 kDa (MW of target protein)