Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

PMM1 Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PMM1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN632467

Kurzübersicht für PMM1 Antikörper (N-Term) (ABIN632467)

Target

Alle PMM1 Antikörper anzeigen
PMM1 (Phosphomannomutase 1 (PMM1))

Reaktivität

  • 16
  • 4
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 16
Kaninchen

Klonalität

  • 16
Polyklonal

Konjugat

  • 10
  • 2
  • 2
  • 2
Dieser PMM1 Antikörper ist unkonjugiert

Applikation

  • 12
  • 10
  • 6
  • 3
  • 3
Western Blotting (WB)
  • Bindungsspezifität

    • 9
    • 3
    • 2
    N-Term

    Spezifität

    PMM1 antibody was raised against the N terminal of PMM1

    Aufreinigung

    Affinity purified

    Immunogen

    PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    PMM1 Blocking Peptide, (ABIN5615430), is also available for use as a blocking control in assays to test for specificity of this PMM1 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMM1 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    PMM1 (Phosphomannomutase 1 (PMM1))

    Andere Bezeichnung

    PMM1

    Hintergrund

    Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

    Molekulargewicht

    30 kDa (MW of target protein)
Sie sind hier:
Chat with us!