C9orf25 Antikörper (Middle Region)

Produktnummer ABIN632464

Produktdetails anti-C9orf25 Antikörper

Target: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C9orf25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C9 ORF25 antibody was raised against the middle region of C9 rf25

Aufreinigung: Affinity purified

Immunogen: C9 ORF25 antibody was raised using the middle region of C9 rf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF25 Blocking Peptide, catalog no. 33R-8849, is also available for use as a blocking control in assays to test for specificity of this C9ORF25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C9orf25

Target: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Andere Bezeichnung: C9ORF25 (C9orf25 Produkte)

Synonyme: C9orf25 antikoerper, bA573M23.5 antikoerper, C15H9orf25 antikoerper, 2310028H24Rik antikoerper, fam219a antikoerper, zgc:101028 antikoerper, family with sequence similarity 219 member A antikoerper, family with sequence similarity 219, member A antikoerper, family with sequence similarity 219, member Aa antikoerper, FAM219A antikoerper, Fam219a antikoerper, fam219aa antikoerper

Hintergrund: The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.

Molekulargewicht: 18 kDa (MW of target protein)