FAM50B Antikörper (N-Term)

Produktnummer ABIN632462

Produktdetails anti-FAM50B Antikörper

Target: FAM50B (Family with Sequence Similarity 50, Member B (FAM50B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM50B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM50 B antibody was raised against the N terminal of FAM50

Aufreinigung: Affinity purified

Immunogen: FAM50 B antibody was raised using the N terminal of FAM50 corresponding to a region with amino acids EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM50B Blocking Peptide, catalog no. 33R-2677, is also available for use as a blocking control in assays to test for specificity of this FAM50B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM50B

Target: FAM50B (Family with Sequence Similarity 50, Member B (FAM50B))

Andere Bezeichnung: FAM50B (FAM50B Produkte)

Synonyme: RGD1563458 antikoerper, D6S2654E antikoerper, X5L antikoerper, D0H6S2654E antikoerper, XAP-5-like antikoerper, family with sequence similarity 50, member B antikoerper, family with sequence similarity 50 member B antikoerper, Fam50b antikoerper, FAM50B antikoerper

Hintergrund: FAM50B may be involved in growth regulation.

Molekulargewicht: 39 kDa (MW of target protein)